Choosing the Right App Development Company: What You Must Know Before Hiring

writerSalman Ansari

blog dateApr 5, 2022

reading time9 min.

share iconshare iconshare iconshare icon
post-cover_image

Introduction

Today, your app is often the first touchpoint for customers; if it fails, your brand suffers.
 

​With thousands of agencies and freelancers available, choosing the right app development company can feel confusing and risky.
 

​This blog will help you quickly understand what to check, what to avoid, and how to confidently pick a partner that actually delivers results.​

 

Why hire an app development company?

• A full-fledged team (strategist, UI/UX designer, developers, QA, DevOps) brings more skills and stability than hiring one or two freelancers.
 

• ​Experienced companies already know the common pitfalls, best practices, and technical standards required to ship high-quality apps faster.
 

• ​You save internal time: your team can focus on marketing, operations, and growth while experts handle design, development, testing, and deployment.​
 

• Good agencies offer end-to-end services, discovery, design, development, testing, launch, maintenance, and upgrades under one roof.
 

• ​Professional companies usually follow structured processes (Agile, code reviews, automated testing), which reduces bugs and long-term costs.​

 

Key factors to check before hiring

1. Experience and domain expertise

• Prefer companies that have already built apps similar to yours (eCommerce, fintech, healthcare, on-demand, education, etc.).
 

• ​Check how long they’ve been in business and what technologies they specialize in (native Android/iOS, Flutter, React Native, web, backend).
 

• ​Ask what type of clients they work with: startups, SMBs, enterprises, or product companies – this reveals how they think and execute.

 

2. Portfolio, case studies, and reviews

• Review their portfolio to see real apps, design quality, performance, and complexity of projects they handled.
 

​• Read client reviews on platforms like Clutch, GoodFirms, or Google to understand reliability, communication, and delivery quality.
 

• ​Check case studies that show the problem, solution, tech stack, timelines, and business outcomes – not just screenshots.

 

3. Technical skills and stack

• Confirm they can build what you actually need: native (Kotlin/Swift), cross-platform (Flutter/React Native), or web + backend APIs.
 

• ​Ask about their experience with scalability, performance optimization, integrations (payment gateways, third-party APIs, analytics), and cloud deployment.
 

• ​Ensure they have strong QA and testing practices (manual + automated), and can handle app store guidelines and submission.

 

4. Design, UI, and UX focus

• A good company doesn’t just write code; it cares about usability, flow, and a clean, modern UI that users understand instantly.
 

• ​Ask to see Figma/Adobe XD designs or previous UI work to check if their style matches your brand and audience.
 

• ​Confirm they involve UX research, wireframes, and prototypes before jumping into full development.

 

5. Development process and methodology

• Companies that use Agile (Scrum/Kanban) usually deliver in sprints with regular demos and feedback loops.
 

• ​Ask how they break down the project: discovery, planning, design, development, testing, launch, and post-launch support.
 

• ​Check what project management tools they use (Jira, Trello, Asana, ClickUp, etc.) and how they track progress.​

 

6. Communication and collaboration

• Clear communication is critical: you should know who your main contact is (PM, tech lead) and how often updates will be shared.
 

• ​Ask about meeting frequency (weekly/bi-weekly), reporting style, and preferred channels (email, Slack, Zoom, Teams).
 

• ​Observe how they respond before signing: slow, vague, or pushy communication now usually means bigger problems later.

 

7. Security, compliance, and data protection

• Ensure they follow security best practices: secure coding, data encryption, protected APIs, and safe authentication/authorization flows.
 

• ​For sensitive domains (fintech, health, education), ask about compliance with standards like GDPR or relevant regional regulations.
 

• Check if they have NDA policies, code access controls, and secure infrastructure for handling your project assets.

 

8. Pricing, budget, and cost structure

• Typical agency rates globally range roughly from around $25–$150+ per hour depending on region, complexity, and expertise.
 

• ​A complete app project can range from a few thousand dollars for a simple MVP to several tens of thousands (or more) for complex apps.
 

• ​Ask whether they work with fixed-price, hourly, or dedicated team models and what’s included (design, QA, PM, maintenance).
 

• ​Beware of extremely low quotes; they often cut corners on quality, seniority, documentation, or testing.

9. Post-launch support and long-term partnership

• Apps need ongoing updates: OS upgrades, security patches, new features, performance improvements, and bug fixes.
 

• ​Confirm their maintenance model: monthly retainer, hourly bucket, or per-release pricing.
 

• ​Look for a partner interested in long-term collaboration, not just one-time delivery, this helps as your product grows.​

 

Onshore vs offshore: which is better?

Offshore companies (e.g., in India or Eastern Europe) often provide high-quality development at more affordable rates compared to the US or Western Europe.
 

​You can access a wider global talent pool and run near 24/7 development cycles due to time zone differences.
 

​Challenges like time zones and language can be managed with proper processes, overlapping hours, and clear documentation.
 

​For many businesses, offshore or hybrid models offer the best balance of cost, quality, and speed.

 

Quick checklist before you say “yes.”

Use this shortlist before finalizing any app development company:

1. Do they understand your business model, audience, and revenue plan – not just features?
 

2. ​Have they built similar apps and shown clear results through portfolio or case studies?
 

3. ​Is their communication structured, transparent, and easy to follow?
 

4. ​Is the pricing clear, with no hidden extras, and aligned with your expected ROI?
 

5. ​Do they offer post-launch support and a roadmap for future versions?

 

Conclusion – Choose smart, build right with iRoid Solutions

Choosing the right app development company is not just about who can code; it’s about who can understand your goals, suggest the right tech, and stay with you from idea to growth.

When you find a partner that combines strong technical skills, transparent communication, fair pricing, and reliable post-launch support, your chances of building a successful app increase dramatically.

iRoid Solutions helps businesses build scalable, user-friendly, and future-ready mobile apps with a focus on real business outcomes, not just features.​

If you are planning your next Android, iOS, or cross-platform app and want a trusted long-term partner, visit the iRoid Solutions website and head over to the Contact Us page to share your requirements and start the conversation.

Recent Blog Posts

Get a Free Consultation

Have an app, web platform, AI solution, or custom software idea? Share it with us and get practical guidance from an experienced product development team.

Need a mobile app, web app, AI solution, or custom software?

Get a free consultation and discuss your project with our team.bullet

Business

callwhatsappemailskypecalendly

Passionate about mobile apps, websites, AI, and software development?

Join our growing team!bullet

HR

callwhatsappemail

Reach out to us!

mailPic
mailPic