Artificial Intelligence and Machine Learning

about our Artificial Intelligence and Machine Learning service

How We Implement Artificial Intelligence and Machine Learning in Our Development Services

Partner with iRoid Solutions to Unlock the Full Potential of AI and Machine Learning for Your Enterprise

portfolio_thumbnail

Empowering Your Vision with AI Driven Solutions

 

At iRoid Solutions, we help you unlock your business’s true potential with advanced Artificial Intelligence and Machine Learning development. Whether you want to automate workflows, elevate customer experience, or harness data-driven insights, our solutions are built to fit your unique goals. From agile startups to global enterprises, we deliver scalable AI software that makes a measurable impact.

 

Custom AI and Machine Learning Solutions for Real Results

We specialise in building intelligent systems that not only solve current business challenges but also adapt and grow as your users and data evolve. As a trusted AI and ML development partner in India and beyond, we deliver automation, predictive analytics, personalisation, and more—exactly where they matter most.

Need an AI-powered education platform, healthcare automation, or smart chatbot? Our expert team blends technical mastery with deep industry understanding to bring your project to life.

portfolio_thumbnail

Why Businesses Rely on iRoid Solutions for AI & ML

 

  • We apply data science, robust algorithms, and meaningful domain expertise to address real-world problems, not just abstract models.
  • Proven Success
    Recognised among leading AI and ML companies in India and the USA, we have a strong record of successful project deliveries.
  • Custom Tailored Solutions
    Every solution, whether a mobile app, machine learning platform, or end-to-end system, is designed and engineered for your specific needs.
  • Seamless AI Journey, Start to Finish
    We guide you from initial consultation and proof of concept to full-scale deployment and beyond, ensuring you get the most out of your investment.
  • Scalable Offshore Expertise
    Access our specialised offshore team for cost-effective, efficient development with no compromise on quality or timelines.
portfolio_thumbnail

Our AI Driven Development Process

 

  1. We start by understanding your business goals and the areas where AI can make the strongest impact.
  2. Proof of Concept (PoC)
    Our team develops a focused proof of concept to test ideas, validate strategies, and prove model effectiveness before investing in full-scale development.
  3. Model Development & Training
    Leveraging your structured and unstructured data, we build and train sophisticated models using the latest in machine learning techniques.
  4. Integration & Deployment
    We integrate AI features directly into your current platforms, be it a website, mobile application, or enterprise tool.
  5. Testing & Optimization
    Continuous evaluation, validation, and tuning ensure your models stay accurate, relevant, and powerful.
  6. Post-Deployment Support
    We stay committed with ongoing model monitoring, retraining, and feature enhancements as your needs and data shift.
portfolio_thumbnail

Features & Deliverables

 

  • Development of AI-powered chatbots and virtual assistants
  • Voice and image recognition systems
  • Predictive analytics and advanced recommendation engines
  • Natural Language Processing (NLP) and large language model integration
  • Mobile app AI features using SiriKit, CoreML, TensorFlow Lite
  • Real-time model training on your live data
  • Proof of concept development and ongoing AI consulting
portfolio_thumbnail

Industries We Serve

 

  • Education: Adaptive learning platforms and smart content delivery
  • Finance: Solutions for fraud detection, risk scoring, and predictive analytics
  • E-commerce: Personalisation engines, smart inventory, and AI-powered assistants
  • Real Estate: Property recommendation engines and smart lead capture bots
  • On Demand Services: Intelligent matching, scheduling, and service routing algorithms
portfolio_thumbnail

Our AI & ML Technology Stack

 

Area

Tools & Technologies

Languages/Frameworks

Python, R, Java, TensorFlow, PyTorch, Keras, CoreML

AI Platforms

Google Cloud AI, AWS SageMaker, Microsoft Azure AI, IBM Watson

Mobile Integrations

SiriKit, ML Kit, CoreML, TensorFlow Lite

APIs & Libraries

OpenCV, spaCy, NLTK, Hugging Face Transformers

Databases & Tools

MongoDB, PostgreSQL, Apache Kafka, Airflow

Visualization

Tableau, Power BI, Matplotlib

Our Self-explanatory Statistics

Our self-explanatory statistics are a testament to our global reach and unwavering dedication to excellence.

Years in Business

Years in Business

Team Members

Team Members

Happy Clients

Happy Clients

Repeat Clients Ratio

Repeat Clients Ratio

Countries Served

Countries Served

Clients Recommended Us

Clients Recommended Us

Apps Launched

Apps Launched

Websites Launched

Websites Launched

5 Star Ratings

5 Star Ratings

Happy End-users

Happy End-users

Why You Should Hire Us?

  • Decades of IT Excellence in Delivering Top-Tier Solutions.
  • Driving Business With Cutting-Edge Technology.
  • Expertly crafted, customized IT solutions Unwavering commitment to client satisfaction and lasting partnerships.
  • Agile Delivery for Swift, Quality-Assured Project Completion.
  • 24/7 Support: Ensuring Your Business Never Skips a Beat.
  • Security Protocols for Uncompromised Data Protection.
  • Global presence and local expertise in diverse markets.
  • Pioneering IT with a Culture of Perpetual Growth and Learning.
  • Value-Focused Pricing for Superior IT Investment Returns.

Get in Touch With Us

If you are looking for a solid partner for your projects, send us an email. We'd love to talk to you!

Business

Need a mobile app or website?

Get a free consultation!bullet

callwhatsappemailskypecalendly

HR

Passionate about mobile apps & website?

Join our growing team!bullet

callwhatsappemail

Reach out to us!

mailPic
mailPic