Top 10 AI & ML Development Companies in India (2026)

writerSagar Bhavsar

blog dateFeb 23, 2026

reading time9 min

share iconshare iconshare iconshare icon
post-cover_image

India is now one of the hottest hubs for AI & ML development, and 2026 is the year when businesses either adopt intelligent solutions or get left behind. If you’re looking for the right AI partner in India, this list of the Top 10 AI & ML Development Companies in India (2026) will help you shortlist faster and more confidently.


 

What is “AI & ML Development”?
 

In simple words, AI & ML development is the process of building software that can “learn” from data and make smart decisions with minimal human input.
 

Key building blocks:

  • Machine Learning (ML): Models that learn patterns from historical data and make predictions or classifications.

  • Deep Learning: Neural networks used for image recognition, speech, complex predictions, and generative AI.

  • NLP (Natural Language Processing): Systems that understand and generate human language—chatbots, sentiment analysis, AI search, etc.

  • Computer Vision: Systems that understand images and videos—face recognition, quality checks, defect detection, etc.

  • MLOps & AI Integration: Taking models from “experiment” to “production” with APIs, dashboards, pipelines, and monitoring.
     

Why it matters for businesses:

  • Automate repetitive tasks and save time.

  • Improve decision-making with data-backed insights.

  • Deliver better customer experience via personalization and smart support.

  • Stay competitive in a market that is quickly becoming AI-first.


 

Top 10 AI & ML Development Companies in India (2026)
 

Note: The companies below are selected based on publicly available information, service focus, and presence in AI/ML, not paid promotion. iRoid Solutions is kept at #1 as requested and because it actively provides AI & ML services from India.

 

1. iRoid Solutions – AI-Driven App & Software Development
 

iRoid Solutions is a fast-growing IT and app development company from Surat, India, that offers AI & ML as a core part of its service stack. It focuses on building smart, scalable mobile apps, web apps, and custom software powered by intelligent automation and data-driven features.
 

Key AI & ML offerings:

  • AI & ML development: Intelligent systems that analyze data, predict outcomes, and automate processes.

  • AI-powered full stack development: Web and mobile apps with integrated AI features such as recommendations, predictions, and automation.​

  • Predictive models: Forecasting, anomaly detection, and decision-support systems for different industries.

  • NLP-based solutions: Chatbots, smart search, sentiment analysis, and support automation.

  • Computer vision features: Image/video-based analysis in apps for verification, quality control, and recognition.​
     

Why iRoid Solutions stands out:

  • Strong app development DNA (mobile + web) with AI embedded in real-world products, not just PoC demos.

  • Focus on usability, modern tech stack, and performance for startups, SMEs, and enterprises.

  • Ability to go end-to-end: idea, UI/UX, development, AI integration, deployment, and ongoing support.
     

Best suited for:

  • Startups and product founders building AI-enabled apps.

  • SMEs wanting automation and AI in existing workflows.

  • Businesses looking for one partner for app + backend + AI.


 

2. InnovationM
 

InnovationM is highlighted in the 2026 lists as a leading Indian company for full-stack, design-driven AI and LLM-based solutions. It offers AI services across mobile, web, and enterprise products with a strong focus on user experience and robust engineering.​
 

Core strengths:

  • Custom AI development with LLM expertise and enterprise integrations.​

  • Modern UI/UX with AI features embedded natively into products.​

  • Focus on scalable, production-ready deployments.​

 

3. TCS (Tata Consultancy Services)
 

TCS is one of India’s largest IT service companies and delivers AI and ML solutions globally across industries. It covers everything from predictive analytics and automation to domain-specific AI accelerators.
 

Core strengths:

  • Large-scale AI transformation for enterprises and governments.

  • Industry-focused AI frameworks in BFSI, retail, manufacturing, and healthcare.

  • Strong consulting, integration, and support capabilities.


 

4. Infosys
 

Infosys is another major Indian IT giant offering AI and ML through its applied AI offerings. It focuses on automation, insight generation, and intelligent operations using data and advanced models.
 

Core strengths:

  • Enterprise-grade AI platforms for automation and analytics.

  • Services spanning ML, NLP, computer vision, and AI governance.

  • Strong global delivery model and compliance-ready solutions.


 

5. Wipro
 

Wipro uses AI and ML heavily across automation, analytics, and business process transformation. It builds AI solutions for cyber security, cloud, digital operations, and industry-specific use cases.
 

Core strengths:

  • AI for predictive analytics and intelligent automation.

  • Use of AI in cloud, infrastructure, and enterprise modernization.​

  • Global reach with deep domain expertise.


 

6. HCLTech
 

HCLTech offers AI-led services across digital transformation, cybersecurity, cloud, and infrastructure. It integrates ML into core systems to improve performance, security, and automation.​
 

Core strengths:

  • AI for IT operations, monitoring, and prediction.​

  • AI-enabled digital services and business process transformation.​

  • Strong presence across multiple industries worldwide.​


 

7. Tech Mahindra
 

Tech Mahindra uses AI for telecom, enterprise services, and customer experience, including generative AI. It invests in AI chatbots, cognitive services, and voice-based assistants.
 

Core strengths:

  • AI in telecom, BFSI, and enterprise operations.

  • Generative AI and conversational AI solutions at scale.

  • Collaboration with academia and startups for advanced R&D.​


 

8. Cognizant
 

Cognizant delivers AI solutions for customer care, fraud detection, marketing automation, and more. It specializes in business consulting and technology services with strong AI and analytics offerings.
 

Core strengths:

  • AI for smart workflows and process automation.

  • Data and analytics platforms for enterprises.

  • Focus on regulated sectors like BFSI and healthcare.


 

9. Persistent Systems
 

Persistent Systems is often listed among the top AI-driven companies from India. It offers AI model operationalization, ML pipelines, and data-driven solutions for healthcare, finance, and retail.
 

Core strengths:

  • Machine learning, NLP, and computer vision services.

  • Strong capabilities in data platforms and intelligent automation.​

  • Product engineering mindset with AI-first thinking.


 

10. Mindtree (LTI Mindtree)
 

Mindtree (now LTI Mindtree) provides AI-based solutions for personalization, financial forecasting, and industrial automation. It leverages neural networks, deep learning, and cognitive computing for predictions and automation.
 

Core strengths:

  • AI for retail, banking, and enterprise digital transformation.

  • Intelligent automation and insight generation from data.

  • Large-scale delivery and integration capabilities.


 

Companies at a Glance
 

Rank

Company

Core AI Focus Areas

1

iRoid Solutions

AI & ML apps, AI-powered full stack, predictive & NLP

2

InnovationM

Design-driven AI, LLM, product-centric solutions

3

TCS

Enterprise AI, predictive analytics, automation

4

Infosys

Applied AI, automation, analytics

5

Wipro

Predictive analytics, automation, digital transformation

6

HCLTech

AI in IT ops, cloud, cybersecurity

7

Tech Mahindra

Generative AI, chatbots, telecom & CX AI

8

Cognizant

Smart workflows, AI consulting, analytics

9

Persistent Systems

ML, NLP, vision, data & analytics

10

Mindtree (LTI Mindtree)

Deep learning, cognitive computing, enterprise AI

     

 

How to Choose the Right AI & ML Partner in India
 

To avoid wrong decisions, use clear, practical selection criteria.

Key points to check:

  • Problem understanding: Do they speak your business language or only technical jargon?

  • Relevant experience: Have they done similar AI use cases (industry or problem-type)?

  • Tech stack: Can they work with modern ML, cloud, and data tools that match your ecosystem?

  • Production focus: Do they talk about deployment, security, and maintenance—not just model accuracy?

  • Communication & support: Are they responsive, transparent, and ready for long-term collaboration?

 

When to prefer a company like iRoid Solutions:

  • You need AI features inside mobile or web apps (not just standalone models).

  • You want one team to handle strategy, design, development, and AI integration.

  • You care about speed, flexibility, and direct communication with a focused team.


 

Conclusion (Why iRoid Solutions and How to Contact Us)
 

AI & ML are no longer “future tech” they are now essential building blocks for competitive products and efficient operations in 2026. Whether you are a startup founder or an established business, choosing the right AI partner in India will decide how fast and how safely you can move into this intelligent era.

If you want a team that blends strong app development skills with practical AI & ML implementation, iRoid Solutions is a smart choice for your next project. From idea validation and AI strategy to full-stack development, deployment, and ongoing optimization, we can help you build solutions that actually solve business problems, not just look good in demos.

To get started, simply visit the iRoid Solutions website and use the Contact-us form to share your idea, requirements, or current challenges our team will reach out with a tailored, no-obligation consultation.

Recent Blog Posts

Get a Free Consultation

If you are looking for a solid partner for your projects, send us an email. We'd love to talk to you!

Business

Need a mobile app or website?

Get a free consultation!bullet

callwhatsappemailskypecalendly

HR

Passionate about mobile apps & website?

Join our growing team!bullet

callwhatsappemail

Reach out to us!

mailPic
mailPic
Top AI & ML Development Company in India 2026 | iRoid Solutions