App Store Optimisation (ASO) Tips for Faster App Growth

writerSagar Bhavsar

blog dateMay 29, 2026

reading time9min

share iconshare iconshare iconshare icon
post-cover_image

Introduction


Millions of apps fight for attention every single day, and most of them fail for one simple reason: nobody can find them.
 

If your app isn’t ranking in the Apple App Store or Google Play, your growth is already dead before users even see your product.
 

Many developers and marketers struggle with:

  • Low organic installs

  • High paid acquisition costs

  • Poor keyword rankings

  • Weak app visibility

  • Low conversion rates

  • Bad retention signals impacting rankings
     

The truth is simple: app growth starts with visibility and conversion.
 

This guide breaks down proven App Store Optimisation (ASO) strategies used by top-performing apps to dominate rankings, increase downloads, and scale faster.

 

 

What is App Store Optimisation (ASO)?


App Store Optimisation (ASO) is the process of improving an app’s visibility and conversion rate in app stores like Apple App Store and Google Play. ASO involves optimising keywords, app titles, descriptions, screenshots, ratings, and user engagement signals to increase organic downloads.
 

Think of ASO as:

  • SEO for mobile apps

  • A mix of visibility + conversion optimisation

  • The core organic growth engine for apps

 

Why ASO Matters

  • The majority of app downloads come from store searches

  • Apps ranking in top results capture most installs

  • Higher conversion rates improve rankings further

 

The ASO Flywheel

Better ranking
→ More visibility
→ More downloads
→ More ratings
→ Higher ranking

 

 

How App Store Algorithms Actually Work

 

Apple App Store Ranking Factors

  • App name

  • Subtitle

  • Keyword field

  • Ratings & reviews

  • Download velocity

  • Retention

  • In-app events

 

Google Play Ranking Factors

  • App title

  • Short description

  • Long description

  • Engagement metrics

  • Backlinks

  • Android vitals

  • Update frequency

 

Major Differences Between Apple & Google ASO

  • Apple uses a dedicated keyword field; Google does not

  • Google indexes descriptions heavily; Apple does not

  • Backlinks matter more for Google Play

  • Visual assets are critical on both platforms

 

 

Do Keyword Research Like a Pro

 

Why Keywords Control Visibility

Keywords determine whether your app appears in search results. No keywords = no discovery.

 

How to Find High-Traffic Keywords

  • Competitor analysis

  • Autosuggest scraping

  • ASO tools

  • Search trend analysis

 

Best ASO Keyword Tools

  • AppTweak

  • Sensor Tower

  • App Radar

  • Mobile Action

  • Keyword Tool

 

Keyword Selection Formula

Choose keywords based on:

  • Search volume

  • Competition

  • Relevance

  • Conversion intent

 

Mistakes to Avoid

  • Keyword stuffing

  • Irrelevant targeting

  • Only chasing high-competition keywords

 

 

Optimise Your App Title for Maximum Rankings

 

Why the App Title is Critical

Your app title is the strongest ranking signal in ASO.

 

Perfect ASO Title Formula

Brand Name + Main Keyword + Benefit

Example:
FitTrack: Calorie Counter & Weight Loss App

 

Title Best Practices

  • Keep it readable

  • Place primary keyword early

  • Avoid spammy formatting

  • Stay within character limits

 

 

Write App Descriptions That Convert

 

Google Play Description Optimisation

  • Use keywords naturally

  • Include semantic variations

  • Focus on readability

  • Align with user intent

 

Apple App Store Description Strategy

  • Focus on conversion, not keywords

  • Highlight benefits clearly

  • Keep it simple and persuasive

 

Description Framework

  • Hook

  • Problem

  • Features

  • Benefits

  • Social proof

  • CTA

 

 

Screenshot Optimisation - The Most Ignored Growth Lever

 

Why Screenshots Matter

Screenshots directly impact install conversion rates.

 

Best Practices

  • Show benefits instantly

  • Use bold captions

  • Highlight outcomes

  • Tell a visual story

 

Screenshot Sequence Strategy

  1. Core value proposition

  2. Key feature

  3. Social proof

  4. Ease of use

  5. CTA

 

Common Mistakes

  • Cluttered design

  • Small unreadable text

  • Generic UI-only visuals

 

 

App Icons Can Make or Break Installs

 

Psychology Behind Icons

Users decide in seconds whether to click your app.

 

High-Converting Icon Traits

  • Simplicity

  • Strong contrast

  • Recognisable shapes

  • Consistent branding

 

A/B Testing Icons

  • Test variations regularly

  • Measure CTR changes

  • Track install conversion lift

 

 

Video Previews That Increase Conversion

 

Why Videos Matter

Videos help users understand your app instantly.

 

Best Practices

  • Show value in first 3 seconds

  • Focus on benefits

  • Keep under 30 seconds

  • Add captions

 

Common Mistakes

  • Long intros

  • Too many features

  • Weak storytelling

 

 

Ratings & Reviews - The Hidden Ranking Weapon

 

How Reviews Impact Rankings

Higher ratings = higher trust + better rankings.

 

Increase Positive Reviews

  • Ask after success moments

  • Use in-app prompts

  • Resolve issues quickly

 

Handle Negative Reviews

  • Respond professionally

  • Notify users after fixes

  • Use feedback for improvement

 

 

App Retention Directly Impacts ASO

 

Why Retention Matters

Downloads without retention hurt rankings.

 

Key Metrics

  • Day 1 retention

  • Day 7 retention

  • Crash rate

  • Session duration

 

Improve Retention

  • Better onboarding

  • Push notifications

  • Gamification

  • Personalisation

 

 

Localisation - The Fastest Way to Scale

 

Why It’s Underrated

Most apps ignore massive global traffic.

 

Localisation Strategy

  • Translate metadata

  • Localise screenshots

  • Adapt culturally

 

Best Markets

  • United States

  • India

  • Brazil

  • Indonesia

  • LATAM regions

 

 

A/B Testing Your ASO Assets

 

What to Test

  • Icons

  • Screenshots

  • Titles

  • Videos

  • Descriptions

 

Tools

  • Google Play Experiments

  • SplitMetrics

  • StoreMaven

 

Metrics

  • CTR

  • Install conversion rate

  • Retention impact

 

 

Advanced ASO Strategies Most Developers Ignore

 

Competitor Keyword Hijacking

Target keywords your competitors rank for.

 

Seasonal ASO

Optimise for trends like:

  • New Year

  • Fitness season

  • Black Friday

  • Sports events

 

Apple Search Ads Insights

Use ads data to find high-converting keywords.

 

External Signals

  • Backlinks

  • Social traffic

  • Brand mentions

 

 

ASO Mistakes Destroying App Growth

 

Biggest Errors

  • Fake reviews

  • Keyword stuffing

  • Ignoring retention

  • Poor visuals

  • No testing

  • Rare updates

 

Why Apps Plateau

ASO is not one-time:

  • Algorithms evolve

  • Competition increases

  • User behavior changes

 

 

Complete ASO Checklist

 

Metadata

  • Optimised title

  • Keyword research completed

  • Strong descriptions

 

Visual Assets

  • High-converting icon

  • Optimised screenshots

  • Engaging video

 

Trust Signals

  • Review strategy

  • Active responses

 

Performance

  • Fast loading

  • Low crash rate

  • Strong retention

 

 

Future Trends in App Store Optimisation

 

AI-Driven ASO

AI tools will automate keyword and asset optimisation.

 

Voice Search Discovery

Voice queries will influence app search behaviour.

 

Personalised App Stores

Store results will vary per user.

 

Predictive Keyword Intelligence

Tools will forecast keyword trends before they peak.

 

 

Conclusion


ASO is no longer optional. 
 

If users cannot discover your app, your product quality does not matter. 
 

The apps dominating search rankings are not always better, they simply execute ASO better.
 

Stop guessing and start optimising every element of your app listing aggressively. 
 

If you want expert guidance to scale your app’s growth, the team at iRoid Solutions can help you implement data-driven ASO strategies that drive real results. 
 

Contact us today to boost your app visibility, downloads, and revenue.

Blog Related FAQs:

Ans.

ASO is not instant, it typically takes 2 to 6 weeks to start seeing measurable improvements in rankings and downloads. However, consistent optimisation and testing can deliver long-term growth and compounding results over time.

Ans.

ASO (App Store Optimisation) focuses on improving app visibility and conversions within app stores like Google Play and Apple App Store, while SEO (Search Engine Optimisation) is aimed at ranking websites on search engines like Google. Both rely on keywords, but ASO also heavily depends on app-specific factors like installs, ratings, and retention.

Ans.

ASO itself is a cost-effective organic growth strategy, but it may involve costs such as ASO tools, creative asset design, and testing tools. Compared to paid ads, ASO delivers more sustainable and long-term results.

Ans.

Neither is universally better, it depends on your target audience and app category. Google Play offers stronger keyword indexing through descriptions, while Apple App Store provides more control through a dedicated keyword field. Ideally, you should optimise for both platforms.

Ans.

You should review and update your ASO every 4 to 6 weeks. Regular updates help you adapt to algorithm changes, seasonal trends, and performance data from A/B testing.

Ans.

Yes, ratings and reviews are a major ranking factor. Higher ratings improve credibility, increase conversion rates, and signal quality to app store algorithms, which can boost your app’s ranking.

Recent Blog Posts

Get a Free Consultation

Have an app, web platform, AI solution, or custom software idea? Share it with us and get practical guidance from an experienced product development team.

Need a mobile app, web app, AI solution, or custom software?

Get a free consultation and discuss your project with our team.bullet

Business

callwhatsappemailskypecalendly

Passionate about mobile apps, websites, AI, and software development?

Join our growing team!bullet

HR

callwhatsappemail

Reach out to us!

mailPic
mailPic
How to Improve App Store Rankings and Grow Your Mobile App Fast